General Information

  • ID:  hor006888
  • Uniprot ID:  P02818??53-100)
  • Protein name:  Osteocalcin
  • Gene name:  prl2
  • Organism:  Homo sapiens
  • Family:  Osteocalcin/matrix Gla protein family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0030425 dendrite; GO:0005788 endoplasmic reticulum lumen; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005796 Golgi lumen; GO:0043204 perikaryon; GO:0031982 vesicle
  • GO BP:  GO:0005509 calcium ion binding; GO:0005179 hormone activity; GO:0046848 hydroxyapatite binding; GO:0008147 structural constituent of bone; GO:0005198 structural molecule activity
  • GO CC:  GO:0045471 response to ethanol; GO:0051384 response to glucocorticoid; GO:0009629 response to gravity; GO:0033594 response to hydroxyisoflavone; GO:0036005 response to macrophage colony-stimulating factor; GO:0009612 response to mechanical stimulus; GO:0002076 osteoblast development; GO:0033574 response to testosterone; GO:0033280 response to vitamin D; GO:0032571 response to vitamin K; GO:0009410 response to xenobiotic stimulus; GO:0010043 response to zinc ion; GO:0001501 skeletal system development; GO:0048863 stem cell differentiation; GO:0044342 type B pancreatic cell proliferation; GO:0043627 response to estrogen; GO:0014823 response to activity; GO:1903011 negative regulation of bone development; GO:0045670 regulation of osteoclast differentiation; GO:0071363 cellular response to growth factor stimulus; GO:2000224 regulation of testosterone biosynthetic process; GO:0032869 cellular response to insulin stimulus; GO:0071305 cellular response to vitamin D; GO:0034224 cellular respon

Sequence Information

  • Sequence:  LYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  • Length:  48
  • Propeptide:  MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  • Signal peptide:  MRALTLLALLALAALCIAGQAGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA